Protein Info for Shewana3_3320 in Shewanella sp. ANA-3

Annotation: dienelactone hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01738: DLH" amino acids 17 to 243 (227 residues), 90.4 bits, see alignment E=1.3e-29 PF02129: Peptidase_S15" amino acids 18 to 138 (121 residues), 28.9 bits, see alignment E=9.4e-11

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 99% identity to shm:Shewmr7_3217)

Predicted SEED Role

"Candidate 1: dienelactone hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0H5 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shewana3_3320 dienelactone hydrolase (RefSeq) (Shewanella sp. ANA-3)
MLVTQQTQNINTPTGPMRTYVYRPDAPGQFPCILFYSEIFQQTAPIARTATILAGHGFVV
LVPEVFHELNPIGTVLAYDDVGKDKGNADKFAKPLEQHDSDTQALIDFARQQSYCTGKVG
SMGVCIGGHLAYRAALNPEILGAFCLYPTDIHSNTLPCAYGNDSLSRSGDIQGELVLVFG
KQDPHVSPEGRVLIHQQLMAKNRNFSWLEVNAQHAFMRDEGERYDPALALQMYQQSVAFF
HRVLR