Protein Info for Shewana3_3309 in Shewanella sp. ANA-3

Name: rumB
Annotation: 23S rRNA methyluridine methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB" amino acids 6 to 383 (378 residues), 580.3 bits, see alignment E=8.5e-179 PF05958: tRNA_U5-meth_tr" amino acids 215 to 383 (169 residues), 63.4 bits, see alignment E=4e-21 PF05175: MTS" amino acids 244 to 320 (77 residues), 24.7 bits, see alignment E=3.3e-09 PF09445: Methyltransf_15" amino acids 245 to 322 (78 residues), 22.8 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 100% identical to RLMC_SHESA: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to shn:Shewana3_3309)

MetaCyc: 54% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0G4 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Shewana3_3309 23S rRNA methyluridine methyltransferase (RefSeq) (Shewanella sp. ANA-3)
MSTLVQCGYFERGQCQSCRHIKLPMAQQLAAKNLELQQLLAPFVDKTEPQFLPPVVGDSS
GFRNKAKMVALGAAHAPVLGIVSPSGEAVSLCDCLLYPTDMQALLHRLERFVQQAGIPPY
RVDKAKGELKFILLTRSQVRGEYMLRFVLRSRDAIARIERELPTLMAEYPQIKVVSVNLQ
PVHMAILEGEEEIFLTENTRLEERFNDVPLFIRPKSFFQTNPQVAAKLYQTAREWVADFA
PASLWDLFCGVGGFGLHCAAKDIPLTGIEIEAEAIACAKMSAQLMGLDKVEFMALDSTDF
AKGEAAQTKPELIIVNPPRRGIGESLCHSLSEFAPKAILYSSCNPKTLAKDLGHIRGYRL
TKVQLFDLFPHSDHFEVLALLVKD