Protein Info for Shewana3_3297 in Shewanella sp. ANA-3

Annotation: peptide chain release factor 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00020: peptide chain release factor 2" amino acids 8 to 350 (343 residues), 538.7 bits, see alignment E=3.2e-166 PF03462: PCRF" amino acids 18 to 207 (190 residues), 188 bits, see alignment E=1.7e-59 PF00472: RF-1" amino acids 215 to 324 (110 residues), 143.4 bits, see alignment E=3e-46

Best Hits

Swiss-Prot: 94% identical to RF2_SHEB2: Peptide chain release factor 2 (prfB) from Shewanella baltica (strain OS223)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 100% identity to shn:Shewana3_3297)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0F2 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Shewana3_3297 peptide chain release factor 2 (RefSeq) (Shewanella sp. ANA-3)
MPSVRSFLGGIFDYDAKHERLEEVSRELESSEVWNEPERAQALGKERASLEAVVKTIDDM
DAGLEDVEGLLELAIEEEDEDTFNETTKELDYLESRLAELEFRRMFSGQHDASDCYLDIQ
SGSGGTEAQDWANMVLRMYLRWGEAHGFSPELMEVTDGDVAGIKGATIKFTGEYAFGWLR
TETGVHRLVRKSPFDSSGRRHTSFCSVFVYPEIDDDITIDINPADLRIDVYRASGAGGQH
VNRTESAVRITHLPTNTVVQCQNDRSQHKNKDSAMKQLKAKLFELEMHKQNAEKQAAEDA
KSDIGWGSQIRSYVLDDSRIKDLRTSVETRNTQAVLDGDLDKFIEASLKSGL