Protein Info for Shewana3_3286 in Shewanella sp. ANA-3

Annotation: dienelactone hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details PF23678: YqhI" amino acids 13 to 43 (31 residues), 55.8 bits, see alignment (E = 4.6e-19) PF01738: DLH" amino acids 117 to 318 (202 residues), 144.3 bits, see alignment E=8.6e-46

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 100% identity to shn:Shewana3_3286)

Predicted SEED Role

"Dienelactone hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0E1 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Shewana3_3286 dienelactone hydrolase (RefSeq) (Shewanella sp. ANA-3)
MSPQPKSDNNAPAAQPIPQEAFDWYDEYAHGIIDRREFMARLAGLVALGFTMTTLTGALM
PNYALAEQVSFNDPSIQASYVKFPSPEGYGEGRGYLVMPASMLIPGKEAGDSKTLDPTKK
APVVLVVHENRGLNPYIEDVARRLAAKGYIAFAPDALYSLGGYPGNDDAGRAMQASLDRA
KIEQDFIAAARFLKAHPQSNGKLGAVGFCFGGYIVNMLAASIPDELAAGVPFYGTPAATE
LRSRVEGPLMLQFAALDQRINDTWGEYETQLKANKAEYIAYLYPNVNHGFHNDSTARYDE
PTAELAWARTLDFFGKYLQG