Protein Info for Shewana3_3277 in Shewanella sp. ANA-3

Name: cobS
Annotation: cobalamin synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 12 to 251 (240 residues), 116.9 bits, see alignment E=6.3e-38 PF02654: CobS" amino acids 17 to 252 (236 residues), 195.7 bits, see alignment E=5.6e-62

Best Hits

Swiss-Prot: 100% identical to COBS_SHESR: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to she:Shewmr4_0843)

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0D2 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shewana3_3277 cobalamin synthase (RefSeq) (Shewanella sp. ANA-3)
MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIVFW
LTQNWLPAGVSVLLSMVTGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG
ALALMLVLMLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTEKYVRDDESSKSK
PLAQHQGINELFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL
GAAQQICEIVCYFVLLVVGSIL