Protein Info for Shewana3_3260 in Shewanella sp. ANA-3
Annotation: ABC transporter related (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to YVRO_BACSU: Uncharacterized ABC transporter ATP-binding protein YvrO (yvrO) from Bacillus subtilis (strain 168)
KEGG orthology group: K02003, (no description) (inferred from 100% identity to shn:Shewana3_3260)MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"Lipoprotein releasing system ATP-binding protein LolD"
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (3/7 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L0B5 at UniProt or InterPro
Protein Sequence (246 amino acids)
>Shewana3_3260 ABC transporter related (RefSeq) (Shewanella sp. ANA-3) MLSMKNISKVFKTDLVETHALRDFNLEVNEGEFVAVTGPSGSGKTTFLNIAGLLEGFTHG DYFLDGINVSNLSDNKSAAVRNEKIGFIFQGFNLIPDLNLAENIEVPLRYRGFSAKERKR RVEQALEQVGLGARMKHLPTQLSGGQQQRVAIARALAGEPRFLLADEPTGNLDSLMARQV MELLENINQSGTTIIMVTHDPELARRAQRNIQIVDGQVCDFTMYQPNAARSASHGSVDKL VANAQG