Protein Info for Shewana3_3240 in Shewanella sp. ANA-3

Annotation: transport system permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 67 to 88 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF01032: FecCD" amino acids 14 to 331 (318 residues), 293.7 bits, see alignment E=7.5e-92

Best Hits

Swiss-Prot: 47% identical to BTUC_PHOPR: Vitamin B12 import system permease protein BtuC (btuC) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to shn:Shewana3_3240)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L095 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Shewana3_3240 transport system permease protein (RefSeq) (Shewanella sp. ANA-3)
MLQHRWLWPTMATLLILSSLLSVSVGPVNISLIDSLSAVFNWATEQNIGNLAPHEQLVVS
NVRLPRTLLALAVGAMLAQCGAVMQGLFRNPLADPGIIGVSSGAALGAAICIVQFPHAES
VMISVSAFSSGLITTLIVYRLASSALGTSVVLLLLSGVAVAALAGAGIGVLTYLANDMAL
RDLTLWQMGSIAGAQWQYVGLCLVVLALLSWQFNRDAKALNALLLGEAEARHLGIDVDSL
KLRLILLCALGVGVSVAATGIIGFIGLVVPHLVRMLLGPDHQRLLPMSALLGAALLALAD
IGARAFLPPAELPVGLVTALIGAPFFIFLLLQQRSKLI