Protein Info for Shewana3_3235 in Shewanella sp. ANA-3

Annotation: TonB-dependent heme/hemoglobin receptor family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 45 to 695 (651 residues), 568.8 bits, see alignment E=1.8e-174 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 46 to 695 (650 residues), 432.7 bits, see alignment E=2.7e-133 PF07715: Plug" amino acids 59 to 163 (105 residues), 93.5 bits, see alignment E=1.2e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 284 to 668 (385 residues), 174.6 bits, see alignment E=7e-55

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to shn:Shewana3_3235)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L090 at UniProt or InterPro

Protein Sequence (695 amino acids)

>Shewana3_3235 TonB-dependent heme/hemoglobin receptor family protein (RefSeq) (Shewanella sp. ANA-3)
MQKKPLVIAIAIALTTTALSFTLAAEEGVTAQQKEKKPELVETEFDEVLVSATRLSEKVS
QTSRSVAVVSEEQLNVAQASSVAEALKNEANITLTNGPRATSQGVEIRGLSGDRVLQTID
GARQNTSSGHRGSYFMDPELLKSIEVIRGPASSLWGSGAIGGVVAQNTKSAQDFLAPNET
FGGYLKQGYDTNGDRTKTSAAVYGQQDTIDWLINGSYFDSNNINTGNDETLTNSASLGSS
GLAKFGWQADEASRLELSARVNKINELVPSNPSAAVSSSVPLVRRKTDDQNVTLNYSLAP
ANNPYLDTKVQVYWNSTDYDEDRVTKGQFDSTEYRTIGINLNNSSQLGNTKLTYGVDGYR
DTLKTVRDDRGQVGQRPGDIDGETTVWGAFTRADIQLTQTVNLDAALRYDSFKNESHNLN
ASADDNELSPSLGLSWQTQPWLTLSARYDQAFRAPTVEEMFSTGTHYCIPPIPGFLPQGL
CNTFATNPNLKSEVARNKELKADFRFNNLAGDDELAFTVNIFRNDVDDFIVQQVSNPLMG
IPGFEQTTSWNNVEDAQLTGFELSGRYRIGQTRLAMNYGQTRGEDRKTGDYIEGMPANKF
NVDLSQGIMEGDMKLGTRVTYVASQSNTPEGYRVAKYDDYTLWDVYLAWEPAMGAMSGLR
VDFAIENIGDEKYQQAWQTLYQSGRNMKLSARYMF