Protein Info for Shewana3_3224 in Shewanella sp. ANA-3

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 202 (187 residues), 117.8 bits, see alignment E=2.3e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_3132)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L079 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Shewana3_3224 lysine exporter protein LysE/YggA (RefSeq) (Shewanella sp. ANA-3)
MSFSTWLGLLAICCLGAMSPGPSLAMVVRHTLGGGRGKGIVCAWAHSIGIGIYALVTLLG
LAVVLKKAPLIFNGIAILGALYLAWMGIQALRSNGGMQAKLAAGEATDTLTAARDGIAIS
LFNPKIMLFFLALFSQFVMVADSLTGQALIVLTPLVVDGLWYTLIALLLSHSSVLPKLRE
KAGLIDKLSGVVLILLAIRVVYTL