Protein Info for Shewana3_3182 in Shewanella sp. ANA-3

Annotation: MltA-interacting MipA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF06629: MipA" amino acids 55 to 304 (250 residues), 150.2 bits, see alignment E=5.2e-48

Best Hits

KEGG orthology group: K07274, outer membrane protein (inferred from 100% identity to shn:Shewana3_3182)

Predicted SEED Role

"MltA-interacting protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L037 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shewana3_3182 MltA-interacting MipA family protein (RefSeq) (Shewanella sp. ANA-3)
MLICCLLSTDIKPERKIMYRILFILLAALSLPSIGMAKEPCVTKDECIEMRNWDLGVAIG
WGQKTNPLRDFDDIPVFFIPTVAYYGEHWFFDNGNLGYSLTEQKYFSLNLVTSYSLDRAY
FYRWDPSNIFLKRSSQEEARLLSTNTALSSEPDPVFNSLESRNFTMLGGAEAFIYSPLGV
VRLAYTHDMFNVHQGSEAQIKWTYGWHLTRWLMDMSLVFDWKSTNVVDYYYGVRPSENDY
WSQHYHADAGWNKGIEMTARYILTDNWDMLFAFRYTQLADEIAASPLLDQDYSSTYFIGA
TYRF