Protein Info for Shewana3_3180 in Shewanella sp. ANA-3

Annotation: GPR1/FUN34/yaaH family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 139 (17 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 3 to 176 (174 residues), 133.5 bits, see alignment E=4e-43

Best Hits

Swiss-Prot: 64% identical to SATP_SHIFL: Succinate-acetate/proton symporter SatP (satP) from Shigella flexneri

KEGG orthology group: K07034, (no description) (inferred from 98% identity to son:SO_3588)

MetaCyc: 64% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"Gpr1/fun34/yaaH family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L035 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Shewana3_3180 GPR1/FUN34/yaaH family protein (RefSeq) (Shewanella sp. ANA-3)
MSTKLANPAPLGLMGFGMTTILLNIHNAGYFPIDAMILAMGIFYGGLGQIIVGIMCFMRG
DTFGTTAFTSYGLFWLTLVGLILMPNAGIAASPTHFMGWYLTLWGIFTAFMFVGSLRYPR
AKQFVFASLTILFFLLAARDFTGSALIGTIAGFEGIICGASAIYFAMAQVLNNEYGRTIL
PIGELKAKA