Protein Info for Shewana3_3144 in Shewanella sp. ANA-3

Annotation: amino acid carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 62 to 88 (27 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 257 (10 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 14 to 440 (427 residues), 493.2 bits, see alignment E=3.1e-152 PF01235: Na_Ala_symp" amino acids 50 to 451 (402 residues), 528.8 bits, see alignment E=5.4e-163

Best Hits

Swiss-Prot: 47% identical to ALST_BACSU: Amino-acid carrier protein AlsT (alsT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to shn:Shewana3_3144)

Predicted SEED Role

"Na(+)-linked D-alanine glycine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZZ9 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Shewana3_3144 amino acid carrier protein (RefSeq) (Shewanella sp. ANA-3)
MLETIVNFLNALLWGKLLVYGLVGAGLYFTLRLVFIQLTHFKHSLKVMTMSRQGCESGLS
SFQVFCTSMAARVGAGNMAGVAVAIGAAGPGAVFWMWLIAMLGMATAMVESTLAQVYKVR
DTNGQFRGGPSYYMEKGLGQRWMGVLFAFFLIIAFGLVFNAVQANTITGAMERVFGFNPT
YVGIGLVLASGFVIVGGLRKVARVSEFIVPIMALAYILIAFIIVLFNLDQLPAIISLIVK
SAFGWQEAAAGGVAYTVAQAMQAGIARGLFSNEAGMGSAANVAASASPNPNHPASQGFVQ
MMGVFVDTIVICTATAAIILLSGDIGSSEDGIRLTINAMSNHVGDWGGAFIAIAIFLFCF
TSIIANYSYAETNVMFLTGNSTKALPLFRLCVLGMVMFGAVAKISLVWNLADVSMGLMAT
VNIIALLLLSGLAIRVINDYCEQLKSGKMPEFDRSKFPELMEQLDDGIWQDNSANEQAKA
RTESALSR