Protein Info for Shewana3_3104 in Shewanella sp. ANA-3

Annotation: rare lipoprotein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03330: DPBB_1" amino acids 34 to 123 (90 residues), 91.4 bits, see alignment E=1.7e-30 TIGR00413: rare lipoprotein A" amino acids 36 to 130 (95 residues), 132.8 bits, see alignment E=7.9e-43

Best Hits

KEGG orthology group: K03642, rare lipoprotein A (inferred from 98% identity to shm:Shewmr7_3007)

Predicted SEED Role

"Lipoprotein A family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZV9 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Shewana3_3104 rare lipoprotein A (RefSeq) (Shewanella sp. ANA-3)
MSLKYLSLTLMLLATLALSGCSSTHSGNWQGFTESGQASFYGDKHQNKKTASGERYNHKL
KTAAHKEIPFGSVVKVTNLKNGKTVVVKVNDRGPFVRGRIIDLSKSAFSSIGNTSAGLLD
VKIEVIQAASQ