Protein Info for Shewana3_3100 in Shewanella sp. ANA-3

Annotation: XRE family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF13560: HTH_31" amino acids 29 to 71 (43 residues), 30.8 bits, see alignment 5.9e-11 PF12844: HTH_19" amino acids 31 to 74 (44 residues), 32.7 bits, see alignment 1.1e-11 PF01381: HTH_3" amino acids 33 to 85 (53 residues), 52.5 bits, see alignment E=7.9e-18 PF07883: Cupin_2" amino acids 134 to 201 (68 residues), 76.7 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to she:Shewmr4_2921)

Predicted SEED Role

"Putrescine utilization regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZV5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Shewana3_3100 XRE family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MFGMMFILNNLFFIYRGNRSFGEMRNLDIGASLRTVRKMKGLSQRELAKRAGVTNSTISM
IEKNSVSPSVSSLKKVLSGIPMSLVDFFSIEASIESEQKVVYRSDELLDIGTGPLEFKLI
GRDFPNRAMSVMSETYPPGSDTGEEMLKHEGEEAAMVIEGKFELTVGDEVYILEAGDSYY
FNSELPHRFRNPFDEPCRLVSATTPANF