Protein Info for Shewana3_3095 in Shewanella sp. ANA-3

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 80 to 106 (27 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 298 (198 residues), 64.3 bits, see alignment E=6.2e-22

Best Hits

Swiss-Prot: 63% identical to POTH_ECOLI: Putrescine transport system permease protein PotH (potH) from Escherichia coli (strain K12)

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 99% identity to she:Shewmr4_2916)

MetaCyc: 63% identical to putrescine ABC transporter membrane subunit PotH (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZV0 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Shewana3_3095 binding-protein-dependent transport systems inner membrane component (RefSeq) (Shewanella sp. ANA-3)
MKMKSKLKWLKGRFWTISFPYAWLLLFFALPFAIVLKISFSTAAISIPPYEATFQYADDV
LNIFLHLGNYLMLLDDSLYYTAYLSSLKMALISTIGCLIIGYPMAYAIARAPARLQTVLL
LLVMLPSWTSFLIRVYAWMGILSNTGIINNTLMWLGIISDPLQILNTNIAVYIGIIYAYL
PFMILPLYATLVKLDMSLIEAASDLGSSRLNTFWKITFPLSKSGVIAGSMLVFIPAVGEF
VIPELLGGPDSLMIGKVLWQEFFNNRDWPVASSLAIVMLALLIIPITLFHRYQARSLEKD
L