Protein Info for Shewana3_3094 in Shewanella sp. ANA-3

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 265 (191 residues), 58 bits, see alignment E=5.5e-20

Best Hits

Swiss-Prot: 67% identical to POTI_ECOL6: Putrescine transport system permease protein PotI (potI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 100% identity to shm:Shewmr7_2997)

MetaCyc: 67% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZU9 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Shewana3_3094 binding-protein-dependent transport systems inner membrane component (RefSeq) (Shewanella sp. ANA-3)
MKKLSFSSVMLWFGLFFLYAPMLILVIYSFNESKLVTVWGGFSPKWYGELFADQQILDAV
WTSLRIAFYSSTMAVIIGTMAAFVMTRFKRSWAKLTLSNMITAPLVMPEVITGLSLLLLF
VHMADLLGWPKERGMVTVWIAHSTFCAAYVAVVVSSRLRELDMSIEEAAMDLGATPLKTF
FLITVPMISPALVAGWLLSFSLSLDDLVIASFASGPGATTLPMVVFSSVRLGVSPKINAL
ATLIILCVSLIAFLSWYMARRAEKRERMPLN