Protein Info for Shewana3_3058 in Shewanella sp. ANA-3

Annotation: tyrosyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00234: tyrosine--tRNA ligase" amino acids 6 to 396 (391 residues), 414.5 bits, see alignment E=2.6e-128 PF00579: tRNA-synt_1b" amino acids 30 to 317 (288 residues), 287.3 bits, see alignment E=1.4e-89 PF22421: SYY_C-terminal" amino acids 323 to 392 (70 residues), 28.4 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 98% identical to SYY_SHEON: Tyrosine--tRNA ligase (tyrS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to she:Shewmr4_2880)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZR3 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Shewana3_3058 tyrosyl-tRNA synthetase (RefSeq) (Shewanella sp. ANA-3)
MADLDQVLAEIRRGTDEILLESDLLEKLKEGRPLRIKLGADPTAPDIHLGHTVILNKLRL
FQELGHEVIFLIGDFTGMVGDPSGKNSTRPPLTREQVLANAETYKEQVYKILDPAKTRIE
FNSSWLEPLGAAGMIRLASQQTVARMMERDDFKKRYASGQSIAIHEFMYPLLQGYDSVAL
KADVELGGTDQKFNLLMGRELQKAEGQKPQAVIMMPLLEGLDGVKKMSKSAHNYIGVSEP
TNEMFGKIMSISDELMWRYFELLSFRPLAEIEQFKQDIANGANPRDTKIALAKEIIARFH
DQAAAESAHQAFIDRFQKGAIPDDIPEVELAAGEGLAIANLLKDADLVGSTSDAMRMIKQ
GAVKMDGEKVDDSRMTLSAGTVAVFQVGKRKFAKVTLV