Protein Info for Shewana3_3053 in Shewanella sp. ANA-3

Annotation: cobalamin biosynthesis protein CbiB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 69 to 97 (29 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details PF03186: CobD_Cbib" amino acids 23 to 301 (279 residues), 106.2 bits, see alignment E=1e-34

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to shn:Shewana3_3053)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZQ8 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Shewana3_3053 cobalamin biosynthesis protein CbiB (RefSeq) (Shewanella sp. ANA-3)
MHSSFYQQLVEIDGALFEGFLVLFFALLLARLAPLPREMQPLIWFSHLAKQLAAKVNRPG
RAPSQQATAGFLAMLLLVFPFWAIITFLLELAAFPWFFEFLVLYLCLTDAGFSQVADEIA
KALKREDNASAKKLLQPWIVRDTDNLSEVGLTKATIEKLATAPIYGTASTIFFFAIAGAP
MVLAVRMIKQLELSWPPIQPKYQHFCSSVHVISTTLLAIPAWLWSLSIAIQGGPKALALL
FRTSKNHPALRGYVMSVSLVANILRIELGGPQKFSGQRIDVAKIVYGPQPHQEMIAPAVK
LASRACAIWFSFITLLPIIWAGLRWLQTL