Protein Info for Shewana3_3041 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 7 to 40 (34 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 171 (30 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 263 (252 residues), 176.4 bits, see alignment E=4e-56

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to shn:Shewana3_3041)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZP7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shewana3_3041 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MDSLLSVFFICLALGAFVGFMAGLLGIGGGLIVVPALLYILPSVGITSAQLPHIAIATSL
AAIILTSISSARAHHKRGNVPWGLFRTMFPGIILGALMSGFIAEQIPAATLRQGFAIFVM
LMAIQMAYPFKTESNRELPNSMVLFVVAVIVAAIAGLMGIGGGVLLVPFLTYFGLQMRLA
VGFSAATGLLISLSGSLGYIIAGFNAPDLPEGTLGYIYLPALFGLIITSILMAPVGVKAA
STWPTSVLKKIFALLLLCVGLKLILS