Protein Info for Shewana3_2983 in Shewanella sp. ANA-3

Annotation: peptidylprolyl isomerase, FKBP-type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01346: FKBP_N" amino acids 21 to 58 (38 residues), 45 bits, see alignment E=1.7e-15 PF00254: FKBP_C" amino acids 66 to 153 (88 residues), 100.6 bits, see alignment E=5.1e-33

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 99% identity to shm:Shewmr7_2887)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase / Macrophage infectivity potentiator"

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZI9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shewana3_2983 peptidylprolyl isomerase, FKBP-type (RefSeq) (Shewanella sp. ANA-3)
MKMLLAVVVIAGVIFYFFTSMNNQKAAQENIRLGNEFLAQNKNQEGVKTTASGLQYQVLQ
QGTGTVHPKASDTVTVHYHGTLIDGTVFDSSVERGEPIAFPLNRVIKGWTEGVQLMVEGD
KYRFFIPSELAYGNRSTGKIGGGSVLIFDVELLKIN