Protein Info for Shewana3_2978 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 112 to 155 (44 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details PF04235: DUF418" amino acids 244 to 395 (152 residues), 122.9 bits, see alignment E=6.7e-40

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 100% identity to shn:Shewana3_2978)

Predicted SEED Role

"Putative xanthosine permease" in subsystem Xanthosine utilization (xap region)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZI4 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Shewana3_2978 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MPAIKPITQAAKDPWGNPIDATHTLHRPIPIGRNANLDAIRGLAVLGIFFMNIYFMGISF
YGYAPHQIPLLSDQVLEAFSNFFIEGRFISLFSILFGVGLYIQYQRFSDKGLAAYSLLLS
RLKWLIVFGLIHGIIIWPGDILLTYGISGFLALCYRDASIAELKRKANIFIFSSLVVICL
ISIMGSDELFTRESPLFAEQYSAWTSGYANQLFLHVMQVGYMALVIPFTLMWFTGGLMLL
GMALYRQGSFEQGFERNTLIKLVLASLVLSALDTLLSLTQNPILVMFSDIIVMLSAIPTA
LIYIHILVKICQNRSAVLRPLQNVGKLAFSLYILQSIVGVFIFRHLAPELILTLDRGGYM
AIALGYSLLQLLLAGLYLRYFNQGPLEKLWRQLAFKSINASSHLNSNNEQQKSQ