Protein Info for Shewana3_2848 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 54 (23 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details PF00782: DSPc" amino acids 102 to 233 (132 residues), 69 bits, see alignment E=1.1e-22 PF22785: Tc-R-P" amino acids 109 to 199 (91 residues), 44.6 bits, see alignment E=5.5e-15 PF22784: PTP-SAK" amino acids 110 to 199 (90 residues), 34.4 bits, see alignment E=6.9e-12 PF00781: DAGK_cat" amino acids 244 to 369 (126 residues), 92.7 bits, see alignment E=4e-30 PF01513: NAD_kinase" amino acids 285 to 360 (76 residues), 26.3 bits, see alignment E=2.4e-09

Best Hits

KEGG orthology group: K07029, (no description) (inferred from 100% identity to shn:Shewana3_2848)

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ56 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Shewana3_2848 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLSRVHIKYFYLFGALLFGYFAVTGHSPILTFIWAWSSLSLALVGSAYWFNLASIFRKRQ
DGSIPWYIRWGFIPFLLGCRLYNLWARRRDSVPSMQAIDKYLYLGSRLSAADLPKLNRYG
ITAILDVTAEFDGLDVSLYEEHIDYLNIPILDHSVPTSAQLNQAINWLHRQVRAQKRVLI
HCALGRGRSVMVLAAYLVCRRPELSFAEVLQQIKSIRKTAGLNRWQLKALEQMYTQGEIK
LHKRAWIIANPVSGAGKWQSHGEQICTELKRYFEVQLALTTPEISAQTQAKKARLQGADI
IIACGGDGTVTEVAAEIIDTDITLGIIPLGTTNALSHALFGLSSKLNAVSQALDNIIQGQ
TQTIDTARCNERLVLLLVGIGFEQQMIESASRERKNALGQLAYLDGLWRAVNTDTNLELQ
LTLDDQAPMAVQTHSLVVANAAPFTSLLAQGKGEPNMTDGLLDITWLDSNNEPNEQLISL
AELAFTGWIKEATNSDSAPSANTGKVKHAHAKRVKISSQPPCKYVIDGEICEPEELNIDI
LPASLKVFVPYQAQNAEPQSESKIS