Protein Info for Shewana3_2799 in Shewanella sp. ANA-3

Annotation: tRNA(Ile)-lysidine synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 24 to 212 (189 residues), 173.3 bits, see alignment E=5.3e-55 PF01171: ATP_bind_3" amino acids 25 to 208 (184 residues), 172.6 bits, see alignment E=1.1e-54 PF09179: TilS" amino acids 262 to 329 (68 residues), 57.4 bits, see alignment E=2.2e-19 PF11734: TilS_C" amino acids 387 to 457 (71 residues), 81.7 bits, see alignment E=2.9e-27 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 389 to 433 (45 residues), 27.6 bits, see alignment 1.6e-10

Best Hits

Swiss-Prot: 83% identical to TILS_SHEON: tRNA(Ile)-lysidine synthase (tilS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to shn:Shewana3_2799)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ07 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Shewana3_2799 tRNA(Ile)-lysidine synthetase (RefSeq) (Shewanella sp. ANA-3)
MAAVELCAHIARFLASLPLQAGSKLVLAYSGGVDSEVLAYGLSEFAKHHPEFHYQLIYVH
HGLSPNADAWAEHCQTRAANYGLPITVERVQLTLGPRVSIEAEARKMRYQAILQHLKPQD
VLLTAHHEDDQLETILLALKRGQGPKGLAAMGQIQMLPLGEKGACLQVRPLLDISREQIE
AFAQTRQLVHIEDESNQDDKYDRNFLRLEIIPRLKARWPSIATTASRSAQLCAEQQAVVD
AEVSERLPKLLTEAHFTQQTVLKLDELATQTSEWQGLLLRGFIESQGFGLPSYVQLQQIL
QQLMGAKEDAKVQLQIGDCVLRRFAGMLYLDTVNTVSAAPRITTRELHQDILALLTQAST
RVEDKIAPFTLATTGPRLCLPKAGEVVSLRYQLPGQFRCQPHFRDKGRELKKLWQECAVP
PWLRAEVGFLFYNERLVMALGLWVEKAFCAQGDDVGLKFDGQAIG