Protein Info for Shewana3_2769 in Shewanella sp. ANA-3

Updated annotation (from data): Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)
Rationale: Specifically important for: L-Isoleucine. specificity for isoleucine indicates that 2-methylbutanoyl-CoA is a substrate (SEED_correct)
Original annotation: acyl-CoA dehydrogenase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 116 (111 residues), 111.7 bits, E=5.2e-36
• PF02770: Acyl-CoA_dh_M
  • amino acids 122 to 215 (94 residues), 81.9 bits, E=6.3e-27
• PF00441: Acyl-CoA_dh_1
  • amino acids 227 to 377 (151 residues), 178.6 bits, E=1.8e-56
• PF08028: Acyl-CoA_dh_2
  • amino acids 244 to 365 (122 residues), 88.3 bits, E=1.1e-28

Best Hits

Swiss-Prot: 56% identical to ACAD8_HUMAN: Isobutyryl-CoA dehydrogenase, mitochondrial (ACAD8) from Homo sapiens

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to shn:Shewana3_2769)

MetaCyc: 47% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.3.99.12)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• valproate β-oxidation (5/9 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.- or 1.3.99.12

Sequence Analysis Tools

See A0KYX7 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Shewana3_2769 Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12) (Shewanella sp. ANA-3)
MDFNFNEDQRQFADLARQFAADELAPFAAKWDEEHHFPKDVIQKAGELGFCSLYSPESEG
GMGLSRLDASIIFEELSKGCTATTAMLTIHNMATWMVTTWGTDTLRQAWSEPLTTGQMLA
SYCLTEPGAGSDAASLQTKAVREGDEYVVSGSKMFISGAGSTELLVVMCRTGQAGPKGIS
AIAIPADSEGIIYGKAEDKMGWNAQPTRLVTFDNVRVPVANLLGEEGQGFTFAMKGLDGG
RINIATCSVGTAQAALERATQYMNERQQFGKPLAAFQALQFKLADMATELVAARQMVRLA
AFKLDSGDPEATAYCAMAKRFATDVGFQVCDAALQIHGGYGYIREYPLERHFRDVRVHQI
LEGTNEIMRLIIARRLLDENAGQIL