Protein Info for Shewana3_2765 in Shewanella sp. ANA-3

Name: fabG
Annotation: 3-ketoacyl-(acyl-carrier-protein) reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF23441: SDR
  • amino acids 3 to 251 (249 residues), 42.1 bits, E=1.8e-14
• PF00106: adh_short
  • amino acids 6 to 204 (199 residues), 171.6 bits, E=3.5e-54
• PF08659: KR
  • amino acids 8 to 172 (165 residues), 47.8 bits, E=4.1e-16
• PF02737: 3HCDH_N
  • amino acids 9 to 56 (48 residues), 22.4 bits, 2.6e-08
• PF13561: adh_short_C2
  • amino acids 14 to 250 (237 residues), 171.6 bits, E=5.5e-54

Best Hits

Swiss-Prot: 33% identical to BAIA2_CLOSV: 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 (baiA2) from Clostridium scindens (strain JCM 10418 / VPI 12708)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 99% identity to son:SO_1683)

MetaCyc: 33% identical to 3alpha-hydroxysteroid dehydrogenase 2 ([Clostridium] scindens)
3OHSTEROXRED-RXN [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]; 1.1.1.395 [EC: 1.1.1.395]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• bile acid 7α-dehydroxylation (2/16 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.395

Sequence Analysis Tools

See A0KYX3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Shewana3_2765 3-ketoacyl-(acyl-carrier-protein) reductase (RefSeq) (Shewanella sp. ANA-3)
MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQEKLERACADLGSATEVQGYAL
DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINV
NLTGTFLCGREAAAAMIESGQAGVIVNISSLAKAGNVGQSNYAASKAGVAAMSVGWAKEL
ARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGQAEEIASTVRFIIENDYVN
GRVFEVDGGIRL