Protein Info for Shewana3_2742 in Shewanella sp. ANA-3

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 188 (173 residues), 69.4 bits, see alignment E=1.5e-23

Best Hits

KEGG orthology group: None (inferred from 98% identity to son:SO_1716)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYV0 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Shewana3_2742 lysine exporter protein LysE/YggA (RefSeq) (Shewanella sp. ANA-3)
MELILAIALFAFSSGITPGPNNIMLMTSGVNFGVKRSIPHLMGISLGFPTMILAIGLGLS
ALFQAYPIIHQVIKIIGIVYLLYLSWLIANSSSKMEGKSIAKPFSFLQAAAFQWVNPKGW
IMAVGAIATFTSVQQDLTPQVVTIATVFLCVAFPCAVVWLGFGVALKRILKNERQQKIFN
ITMAILLVASIIPMIAP