Protein Info for Shewana3_2696 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 400 (376 residues), 53.1 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2696)

Predicted SEED Role

"N-Acetyl-D-galactosamine permease, possible" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYQ4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Shewana3_2696 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MKFTSDSTQATASPQGSFIPMLLIGILFFVFGFVTWLNGALIPFLKIACQLNEFEAYLVT
FVFYIAYFVMALPTSSILTRLGYKMGMTLGLGIMAAGAGLFIVAALVGHFATFLLALFVL
GTGLTLLQTAANPYIVCIGPRESAAMRISLMGIVNKGAGFIVPIIFTAWILTGMEPYSET
ALASLSEAQRQLALTELANRLVHPYLMMMLVLLGLMAFVWFSPLPEPELGERVERTQTDW
KAILQYPQVILGALTLFCYVGAEVIAGDSIGLFSQGLGVAHFGMMTSYTMGFMVLGYVLG
ILLIPRWISQQTALVGSAIAGLLFTLGVLLSDSQSQALSELLLGWLGVLPVPDPVLYLAL
LGLANALVWPAVWPLALEGLGRLTATASALLIMGIAGGAILPLLYGYIAHSQGDSQMAYF
LLLPCYGLIFYYAIWGHKLTAKVASSIAMVNE