Protein Info for Shewana3_2674 in Shewanella sp. ANA-3

Annotation: decaheme cytochrome c MtrF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03507: decaheme c-type cytochrome, OmcA/MtrC family" amino acids 56 to 636 (581 residues), 498.9 bits, see alignment E=1.3e-153 PF22111: MtrC-MtrF_N" amino acids 58 to 178 (121 residues), 193.4 bits, see alignment E=3.5e-61 PF22112: OmcA-like_N" amino acids 101 to 179 (79 residues), 32.9 bits, see alignment E=1.8e-11 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 186 to 312 (127 residues), 91.8 bits, see alignment E=1.2e-29 amino acids 465 to 637 (173 residues), 152.3 bits, see alignment E=3e-48 PF22118: MtrF-like_dom-III" amino acids 319 to 460 (142 residues), 233.6 bits, see alignment E=1.7e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2674)

Predicted SEED Role

"surface localized decaheme cytochrome c lipoprotein, MtrF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYN2 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Shewana3_2674 decaheme cytochrome c MtrF (RefSeq) (Shewanella sp. ANA-3)
MNKFARFSTQFSLLLALTTLLTACGGSDGNDGSPGEPGKPPAMTITSLNIMVDKVAVTDG
IAQVDYQVSNQDDEAVIGIPSATFIAAQLLPQGATGAGNSSEWQHFTSETCAASCPGTFV
DHKNGHYSYRFSATFNGMNGVTFLNDATQRVVIKLGGDALADGTALPITNQHYDWQTSGN
TLAYTRNLVTIETCNSCHSNLAFHGGRYNQVETCVTCHNSKKVSNPADIFPQMIHSKHLT
GFPQSISNCQTCHVDNPDLAERQNWHRVPTMEACGACHTQINFPAGQGHPAQADNSNCVA
CHNADWTASVHGNEDQMAALAQFSPSISSASMDANGTVTVAVTLSNPATGTVYSESADKL
KFISDLRVYANWGTSFDYSTRSARSIRLPESTPVSGSNGTYTYTISGLTVPAGTEADHGG
LAIQGRVCAKDKVLVDCSTELAEVLVIKASHSYFDMSALSATGRREVISNANCASCHGDQ
QLNIHGARNDLAGQCQLCHNPNMQADATAANPSITSFDFKQLIHGIHTSQFAGFEDLNYP
GKIGNCAQCHIKDAAGVSTVALPLNAAVQPLALNNGTFTSPIAAVCSNCHSSDTTHNHMM
QQGAVFAGTKADATAGTETCAFCHGQGAVADVLKVHPIK