Protein Info for Shewana3_2610 in Shewanella sp. ANA-3

Annotation: peptidase M23B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details PF04225: OapA" amino acids 85 to 163 (79 residues), 34 bits, see alignment E=4e-12 PF19425: Csd3_N2" amino acids 169 to 292 (124 residues), 104.9 bits, see alignment E=4.3e-34 PF01551: Peptidase_M23" amino acids 304 to 398 (95 residues), 117.5 bits, see alignment E=3.8e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2610)

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYG8 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Shewana3_2610 peptidase M23B (RefSeq) (Shewanella sp. ANA-3)
MQTGKPNLANFPQIRLQNLSSAHKNILLVGGLLIGAAMLMPNANHVVPTAQRIPVALDLE
TILPQVSEPVETAPIVDNTPHFERVIASGDTLSALFSKAGVDQQTMYKVLEADLNILALD
TLLPGNRIQFWLDNEGQLQKLELYFNAARQVVFTRYEDGSFNVEEINVEGVWQNRIVTGD
IKGSFYVSAQKMGLAAADIQRIEDLLKEKVNFARDLRVGDKFSVLVNDQYVEGEATGSSQ
ILGVSIKTGRSEISAFQHTDGSYYDAKGQSLVRAFQRIPLAKQPRMSSRFNPTRKHPITG
RISPHNGTDFSVPIGTKVIAPGDGVVSLVTDHQFAGKYIVIEHGGKYRTRYLHLSKALVR
KGQRVTRGQVIALSGNTGRSTGPHLHYEFHVNGKPVDPMRADIPMASQLANQELRTFSNI
VKSRQALMNLG