Protein Info for Shewana3_2573 in Shewanella sp. ANA-3

Updated annotation (from data): Cytidine deaminase (EC 3.5.4.5)
Rationale: Specifically important for utilizing Cytidine. Automated validation from mutant phenotype: the predicted function (CYTIDEAM2-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: cytidine deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00383: dCMP_cyt_deam_1" amino acids 50 to 138 (89 residues), 47.7 bits, see alignment E=1.2e-16 PF08211: dCMP_cyt_deam_2" amino acids 156 to 276 (121 residues), 142.8 bits, see alignment E=7.1e-46

Best Hits

Swiss-Prot: 100% identical to CDD_SHESA: Cytidine deaminase (cdd) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to shn:Shewana3_2573)

MetaCyc: 44% identical to cytidine/deoxycytidine deaminase (Escherichia coli K-12 substr. MG1655)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYD1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shewana3_2573 Cytidine deaminase (EC 3.5.4.5) (Shewanella sp. ANA-3)
MQDRFIKSITQLPTPLADALIPLLHQNFAGHIDAQQLAELVQSSKMTEAEVLLALLPIAA
ALAKPPISEFYVGAIAKGKSGDIYMGANLELLGEALFHSVHAEQSAISHAWLSGESQIVD
MIVNASPCGHCRQFMNELVEGGQIKIHLPSQDSHLLSYYLPYAFGPKDLNVQSPLLVKQE
TEFALDSSDPMVIEALDHAGLSYAPYTQSYAAVVLETADGATYCGRYAENAAFNPSMLPM
QMALSNLTRHNRDFGEIRRAVLVESSQGKISLVGATMDALHAVAAIELEHIVVDPV