Protein Info for Shewana3_2560 in Shewanella sp. ANA-3

Annotation: 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 300 to 317 (18 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 1 to 319 (319 residues), 463 bits, see alignment E=2.4e-143 PF00108: Thiolase_N" amino acids 35 to 145 (111 residues), 38.5 bits, see alignment E=1.8e-13 PF00195: Chal_sti_synt_N" amino acids 41 to 168 (128 residues), 32 bits, see alignment E=1.8e-11 PF08545: ACP_syn_III" amino acids 106 to 183 (78 residues), 106.9 bits, see alignment E=8e-35 PF08541: ACP_syn_III_C" amino acids 231 to 319 (89 residues), 121.1 bits, see alignment E=3.5e-39

Best Hits

Swiss-Prot: 98% identical to FABH_SHEON: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 99% identity to she:Shewmr4_2398)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYB8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Shewana3_2560 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq) (Shewanella sp. ANA-3)
MHTKILGTGSYLPVQVRSNQDLEKMVETSDQWIVERTGISERRIAAQDETVSTMGYQAAL
KALEMAGIEASELDMIICGTTSAANAFPAAACEIQAMLGVHTIPAFDIAAACSGFVYALS
VADQFVKNGTAKKVLVIGADVLSRLCEPEDRTTIILFGDGAGAAVIGASDEPGIISTHIY
ADGRQGDLLKCAFPPRQGETSEAVGFMTMKGNDVFKVAVTQLSHVVTETLRLNNIDKSEI
DWLVPHQANFRIINATAKKLDMSLDKVVLTLAKHGNTSAASVPIALDEAVRDGRIQRGQL
LLLEAFGAGFAWGSALVRF