Protein Info for Shewana3_2497 in Shewanella sp. ANA-3

Annotation: aminoglycoside phosphotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 389 to 409 (21 residues), see Phobius details PF01636: APH" amino acids 27 to 109 (83 residues), 24.2 bits, see alignment E=2.8e-09 amino acids 250 to 379 (130 residues), 52.6 bits, see alignment E=5.6e-18 PF01633: Choline_kinase" amino acids 265 to 355 (91 residues), 31.5 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2497)

Predicted SEED Role

"Putative choline kinase, PnuC-associated, THI-regulated" in subsystem PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY57 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Shewana3_2497 aminoglycoside phosphotransferase (RefSeq) (Shewanella sp. ANA-3)
MPPIVDQDKDTLLAVLAQAGLTDISQIQPLAHGLSNHNYHIETPTAHYVLRENADAADSF
CSREQELFYWRHLAKAKLAPELLWVSGDQRYYLSQFIFAQSLPSLPLASQFAPLMEDIEG
RTNLLIEKAILASGTYTLEQPELPREPSMASGYQELSLPNLSLPNLSLPNLSSKALSWKE
LSSKELSWKELESQCSATTFCLGETHIEAWLQSHTDIKGAADKQPWYQSEQLALLDCLTP
NRAHSLLLQLLQQLRVQATGPYHISITEQWQEYHGQLLAFSAADMGEAWQSRLAQLLSIQ
TQIHDWTATLADCLVEPQFCHRDLNPHNLLLKDNQLYCIDFEYATASHPLCELAVVLATH
QLTPVQRYLLVRQYLAGHPGLTSDAIKAIPAAIEMYWVFAVYWALLMAAHTRGERQQEYF
DWFDHFWPLISHTS