Protein Info for Shewana3_2486 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04339: FemAB_like" amino acids 13 to 420 (408 residues), 438 bits, see alignment E=3.2e-135 PF13480: Acetyltransf_6" amino acids 225 to 367 (143 residues), 24.2 bits, see alignment E=3.2e-09

Best Hits

KEGG orthology group: K09919, hypothetical protein (inferred from 100% identity to shn:Shewana3_2486)

Predicted SEED Role

"COGs COG3146"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY46 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Shewana3_2486 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MRQLILAFASAAQSIDASSWDRLMGTDNPFCQHAYILSLELSLSACAATGWRPHHLGVFD
ATGSEFTQELAPDAVIVSQKDAADFMDLPLLALMPLYQKFHSYGEYVFDWAWAQAYERHG
FEYYPKLLNAIPFTPVQGRRLGLSSTLLAEEAQQLSRAVFTCLNEQLVNVDVPMSSWHCL
FVSPSQQALFVEASNPTSLKRLSTQFHWHNRGYADFEAFLAALTSRKRKNILKERAQLQP
YGLQYEFVAGADISREQWQHFIECYQLTYLKRSGHRGYLTPTFFNMIAERLAEQIVLLVV
SDAKGQMLAGALYFTGRNEQGQTCLFGRYWGSIVELEGLHFEACYYQGIEYCIVHGIDIF
DAGAQGEHKVLRGFEPVALYSYHNIAHPDFKRAIAHFTEEEAAQMEVYMQQMREVLPYKK
G