Protein Info for Shewana3_2448 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 38 (32 residues), see Phobius details amino acids 81 to 114 (34 residues), see Phobius details PF04304: DUF454" amino acids 5 to 119 (115 residues), 134.1 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 50% identical to YBAN_ECOLI: Inner membrane protein YbaN (ybaN) from Escherichia coli (strain K12)

KEGG orthology group: K09790, hypothetical protein (inferred from 99% identity to she:Shewmr4_2256)

Predicted SEED Role

"Hypothetical protein DUF454" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KY08 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Shewana3_2448 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MILKRGLFLLIGCLALGLGLLGIVLPLLPTVPFILLAAFCFARSSERLHQWLMTHPWFAD
ALTQWQQHRAMRPGLKRRAMLLTGLSFSVSILVVPIVWVKLLLLTMACGLLWYLKTIPEI
ES