Protein Info for Shewana3_2414 in Shewanella sp. ANA-3

Annotation: cystathionine beta-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF01053: Cys_Met_Meta_PP" amino acids 9 to 388 (380 residues), 385 bits, see alignment E=2.9e-119 TIGR01324: cystathionine beta-lyase" amino acids 9 to 389 (381 residues), 516 bits, see alignment E=2.4e-159 PF00155: Aminotran_1_2" amino acids 38 to 186 (149 residues), 20.3 bits, see alignment E=2.9e-08

Best Hits

Swiss-Prot: 53% identical to METC_SALTY: Cystathionine beta-lyase (metC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to shn:Shewana3_2414)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXX4 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Shewana3_2414 cystathionine beta-lyase (RefSeq) (Shewanella sp. ANA-3)
MTDKHQLATQIVSVGRDKKWTKGVINPPVFRASTIVFDTMEDMRHAAKNKTNGEMFYGRR
GTPTHFAFQAAISELEGGAGTALYPSGAAAISAALLSFLQAGDHLLMVDSVYEPTRDLCS
HILAGFNIETTYYDPLIGEGIRELIRPNTKVLFLESPGSITMEVQDVPTLCRIAHEHGLV
TILDNTWASPINSKPFEMGVDVSIQAATKYIVGHSDVMIGTATANEKHWPQLRERSYLLG
QTTSPDDVYLATRGLRTLGVRMAQHEKNALKVANWLKTRPEVDHLRHPAFDTCPGHEFFK
RDFSAANGLFSFVLKQGDQEAVTALVENMQHFKMGFSWGGYESLILGIFGIEKIRSATQW
DARKPLIRVHIGLEDPDDLIADLSAGFERFNAVLATKAK