Protein Info for Shewana3_2410 in Shewanella sp. ANA-3

Annotation: vault protein inter-alpha-trypsin subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 717 to 735 (19 residues), see Phobius details PF13757: VIT_2" amino acids 87 to 149 (63 residues), 27.1 bits, see alignment E=7.9e-10 TIGR03788: marine proteobacterial sortase target protein" amino acids 87 to 737 (651 residues), 865.3 bits, see alignment E=1.3e-264 PF08487: VIT" amino acids 88 to 196 (109 residues), 107.5 bits, see alignment E=1e-34 PF13768: VWA_3" amino acids 374 to 530 (157 residues), 86.8 bits, see alignment E=4.2e-28 PF00092: VWA" amino acids 375 to 540 (166 residues), 47.8 bits, see alignment E=5.1e-16 PF13519: VWA_2" amino acids 375 to 484 (110 residues), 49.2 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to shn:Shewana3_2410)

Predicted SEED Role

"Inter-alpha-trypsin inhibitor domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXX0 at UniProt or InterPro

Protein Sequence (751 amino acids)

>Shewana3_2410 vault protein inter-alpha-trypsin subunit (RefSeq) (Shewanella sp. ANA-3)
MITGKRVKEVCQTLAMLVIGASICWGLPFAVLASPNSVGTLSAPQNIAATFDEHTASILP
AFSFDDVTQGMLVYQTASGRLMPSLPVDTQVSMQVSGLTNRVSVKQVFSNQTGFVLNGRY
LFPLPNEAAVDSLRLHIGERIIEGQIHPKQQAKQIFEQAKSEGKRASLVSQERPNMFTTE
VANLAPDEELVVEISYQETIHYEDGLFSLRFPLVVAPRYIPGLTLGGNNGERVTSSQVFD
ADRIIAPIRDANSEADPVLKADIKVKLGEGVDKSAVVSPYHPITIDEKQGQLTVALANRV
PANRDFVLQWRLKQGTSPVGWVFNQAGKTHVSQDDNASADTGPTGKSSNTDNYSLVMVLP
PKVEASEQLNLPRELILVIDTSGSMAGDSIIQAKNALRYALRGLRPQDSFNIIEFNSDVS
LLSPTPLPATASNLAMARQFVNRLQADGGTEMAQALNAALPRQAFNAASAEDKSLRQVIF
MTDGSVGNESALFELIRNQIGDNRLFTVGIGSAPNSHFMQRAAELGRGTFTYIGDVDEVE
QKISQLLAKIQYPVLTDLQVRFDDGSVPDYWPAPIPDLYRGEPVLISLKRHPREPQELVI
SGRQGHKNWQQSLSLQANVATDVAQSSAGLDLLWARKQIAALELSKNGANDDKVKQQVTA
LSLNYHLVSPYTSLVAVDLTPIASNAMSRDAVVRQHLPLGWQPMGVLPQTSTSSRFDMLL
GGSVLLLALMLALSIRRQQRQQRALSFALNG