Protein Info for Shewana3_2347 in Shewanella sp. ANA-3

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 56 to 360 (305 residues), 188.5 bits, see alignment E=7.3e-60 PF25954: Beta-barrel_RND_2" amino acids 216 to 287 (72 residues), 34.6 bits, see alignment E=3.5e-12 PF25967: RND-MFP_C" amino acids 291 to 351 (61 residues), 32.2 bits, see alignment E=1.7e-11 PF25989: YknX_C" amino acids 293 to 360 (68 residues), 45.9 bits, see alignment E=8.1e-16 PF25975: CzcB_C" amino acids 294 to 347 (54 residues), 31.9 bits, see alignment 2.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to spc:Sputcn32_3832)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXQ7 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Shewana3_2347 RND family efflux transporter MFP subunit (RefSeq) (Shewanella sp. ANA-3)
MKKPLVLIVGSTFILLIGIVVWGLNFSSKTQDADSKLTAEMMAKSTSKKSQLPPAVSLFK
VTNQTFSQYIVLTGTIEPTKVASLASPAEGPILNLVVREGDTVNLGQEILRIGRTHAADS
LQTSAAEEVRKQVLNLKRIETLVKQHTLPEEQLDEALSSLEKAKAALSQAKQALNDYIVT
VPWSGIISKVLVSDGHFVIPRSPLVEMYDPDSLVLRFSVAEAQALVLKKGHKVKATFDGL
AGQEFELEIIRAYPDLDRKLRTRLFEASLPANEFIPGMFARIRVVQQEHKNTLVIPIDTL
QVQGKDKSVFVVTDNIVTRRLVETGLEQDDQIEVLSGLKAGEIIVLTGIERVKNGSAVRV
LEQPAENNSTGVEK