Protein Info for Shewana3_2324 in Shewanella sp. ANA-3

Annotation: sodium/hydrogen exchanger (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 271 to 287 (17 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 386 (373 residues), 114.4 bits, see alignment E=5.8e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2324)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXN4 at UniProt or InterPro

Protein Sequence (670 amino acids)

>Shewana3_2324 sodium/hydrogen exchanger (RefSeq) (Shewanella sp. ANA-3)
MVEKITGMLALIGVLSLFCQWVGWKLRLPAILPLLLCGLMLGPAFGVLNPDEIFGDLLFP
IISLGVAVILFEGALTLNFKEIKDHGRMVTHLVSIGMVITWGCISVATFYLLNFSWEVAL
LFGALVVVTGPTVIVPMLRSVRPKSQLASILRWEGIVIDPIGALLAVLVFEYITVSGDPT
SHVLYALGSMLTLGLGLGAASGYLIGQVIRRNLLPHYLRNTAVLTLMLGIFVGSNLLQEE
SGLLTVTVMGIWLANMRGVDIAEILEFKETLTVLLISALFILLAARLDSNAMMDLGWGGV
GVLAVTMLVARPLSIWVSGIGTSLSKADKWFLCWIAPRGIVAAAVSSLFAIKLEATNVQG
ADAIVPLVFLIIIGTVVIQSLTAGRWAKYLGVTSGSAQGLLIFGASKFSRELAKILKAKD
IKVLLADSNWDNIRLARMDNIPVYFGNPASEHAETYMDLTGIGRVLIMSPYKQLNPLVTF
YFQDVLGSKKVFGLNNAEQGSARHQLSETYKQRLCLFGDAVSYAKIASQMAKGAQLKVTN
LTENFTFEHFRKRYGETALPLVYLTKEGKVVIVSGNDTQFPNGIELISLLPVEALEEAKI
QQAIAEQEVIAAQAKAAEEAALAKAKAEEEAEAERQRLEQQAKTKADEPSQPEADVQDNI
NTSDETLAKG