Protein Info for Shewana3_2302 in Shewanella sp. ANA-3

Annotation: fumarase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05681: Fumerase
  • amino acids 20 to 294 (275 residues), 316 bits, E=2.1e-98
• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 20 to 293 (274 residues), 208.4 bits, E=1.2e-65
• PF05683: Fumerase_C
  • amino acids 298 to 500 (203 residues), 292.4 bits, E=1.4e-91
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 335 to 496 (162 residues), 160 bits, E=5.1e-51

Best Hits

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 100% identity to shm:Shewmr7_2200)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• mixed acid fermentation (15/16 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

See A0KXL2 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Shewana3_2302 fumarase (RefSeq) (Shewanella sp. ANA-3)
MSSHHETSENVVIKQADFIESVADALQYISYYHPKDFVDAMSEAYEREQSAAAKDAIAQI
LINSRMSAEGKRPLCQDTGIVTTFVKIGMGVKWDKTDMTVQQMVDEGVRRAYTNPDNPLR
ASIVADPAGSRKNTKDNTPSVVHIDMVPGNHIEVAIAAKGGGSENKAKMVMLNPSDDIAA
WVEKTLPTMGAGWCPPGMLGIGIGGTAEKAAVLAKEALMESVDIHELMARGAETSEEKLR
LDIFERANNLGIGAQGLGGLTTVLDVKIKSAPTHAASKPVVMIPNCAATRHVHFHLDGSG
PADLAPPTLSDWPEITREVGSDVRRVNLDTVTQADIEQWKSGETILLSGKMLTGRDAAHK
RIQSLIESGEGLPEGVDFTGKFIYYVGPVDPVGNEVVGPAGPTTATRMDKFTDLMLDKTG
LMGMIGKAERGPATVESIKKHKAVYLMAVGGAAYLVSKAIKKSRVVAFADLGMEAIYEFD
VQDMPVTVAVDSNGVNAHETGPAIWKVNIANAKA