Protein Info for Shewana3_2287 in Shewanella sp. ANA-3

Annotation: LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 410 (406 residues), 493.8 bits, see alignment E=2e-152 PF12704: MacB_PCD" amino acids 27 to 244 (218 residues), 74.9 bits, see alignment E=1.1e-24 PF02687: FtsX" amino acids 278 to 403 (126 residues), 48 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to shm:Shewmr7_1812)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXJ7 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Shewana3_2287 LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq) (Shewanella sp. ANA-3)
MDLRFPLYVGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRIL
GAVPQLTVVTEAPLSDWTIPADKLKALPGVQGVTPSVSTQAMVQSAANIRAVQVFGVFPE
LAEKLSMVAQHTYSGAFNELTSGQYKVILGSELARQLKVSPGDTVRLLSGDGVVYSPLGP
VPSQRKFLVSAVFEMGSQVDAGVAYIHYQDAKRLMRQPSDEINQLRLYLSDPFMAPALAK
DVKQVLTQQGIEATTSDWRDTYGHLFSAVKMEKNMMSLMLSLIVAVAAFNIVSALVMMVV
DKTTDVAVLKTQGLRTSAVMGIFVVQGLLNAVLGLVLGLVVGILLTLNLNGIMATLGISI
LGTGQVLPVKLELGQLSMIIVGTLVVTLVATLYPALRAARVQPATALRYE