Protein Info for Shewana3_2285 in Shewanella sp. ANA-3

Annotation: LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 360 to 370 (11 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 4 to 414 (411 residues), 449.6 bits, see alignment E=5.2e-139 PF12704: MacB_PCD" amino acids 27 to 224 (198 residues), 55 bits, see alignment E=1.4e-18 PF02687: FtsX" amino acids 276 to 408 (133 residues), 43.8 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 43% identical to LOLE_ECOLI: Lipoprotein-releasing system transmembrane protein LolE (lolE) from Escherichia coli (strain K12)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to shn:Shewana3_2285)

MetaCyc: 43% identical to lipoprotein release complex - inner membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXJ5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Shewana3_2285 LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq) (Shewanella sp. ANA-3)
MKGPLALSIGWRFYRARQSNSFISFISFASTAGIALGVAVLIVVLSAMNGFERELEQRLL
GVISQADVVGVNEPIADWRAVEQTAMQIEGITAAAPFIRMQGLVQKPGGFQGLAVVGIDP
EQEAKVSTLAQFMSKETWQGLSEDDNHIVLGESLLKKLGLEVGDTLALYVQDLDPEHAGS
LRAAKSHRFVVSGVYRLGGELELTTAYIPMRYAANILNLHQGVTGVRISVAQVFDAPAKI
RELGYALNQSVYISDWTRTQGHLYQDIQLVRTIMYLVLVLVIGVACFNIVSTLVMAVRDK
ASEIAILMTMGLSRLSVMGIFMVQGALNGLVGCALGGVIGIATAINLSGIARGIEQLLSI
QLLSADVYFVDFLPSELHMTDAGLVIATAFVMSLIATLYPAWKASQIGPAQALAGR