Protein Info for Shewana3_2234 in Shewanella sp. ANA-3

Annotation: putative sulfite oxidase subunit YedY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00174: Oxidored_molyb" amino acids 116 to 277 (162 residues), 123.8 bits, see alignment E=2.9e-40

Best Hits

Swiss-Prot: 58% identical to MSRP_YERPE: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Yersinia pestis

KEGG orthology group: K07147, (no description) (inferred from 100% identity to shn:Shewana3_2234)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KXE4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Shewana3_2234 putative sulfite oxidase subunit YedY (RefSeq) (Shewanella sp. ANA-3)
MANQSRFTPGILKKARWHIQDNQVTPESVFKARRHIVKAMGLGAIGASIPGYVQAGLFDL
FGEQPKTSFITTPLTFEANVRFGKDEVLTPVDKVTTHNNFYEFGTSKQDPSDNAQQFKVD
PWQLRIEGEVERPMTLDYQDLTKLFPLEERIYRLRCVEAWSMVIPWVGFPLAALLKKVGV
TSKGKYVAFETAFDPEQMPGQKSRLMGGGIHYPYVEGLTIAEAMNELTLMSVGLYGKTLP
PQNGAPIRLVVPWKYGFKSIKSIVRIRVMDKQPPTSWNQLAPHEYGFYANVNPAVDHPRW
SQASERRIGEGGLFSAKRIDTQPFNGYGEFVASLYEGMDLRQFY