Protein Info for Shewana3_2135 in Shewanella sp. ANA-3
Annotation: replication initiation regulator SeqA (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 90% identical to SEQA_SHEON: Negative modulator of initiation of replication (seqA) from Shewanella oneidensis (strain MR-1)
KEGG orthology group: K03645, negative modulator of initiation of replication (inferred from 98% identity to shm:Shewmr7_1943)Predicted SEED Role
"SeqA protein, negative modulator of initiation of replication"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KX46 at UniProt or InterPro
Protein Sequence (183 amino acids)
>Shewana3_2135 replication initiation regulator SeqA (RefSeq) (Shewanella sp. ANA-3) MKYIEVDEELYRHIASKTERIGESASDILRRLLGLSVDAVEQAQPQAISQPSLEATTPEP QIAPQIETLVSATDFNQLVDEHKLEQQKGAVGRFLFLLESLYQQSQAQFSQILQIQGRDR LYFARSREELLKASATANPKEIGNTGFWVTTNNNTAKKRAILVEALMQFGCDAQIANGIA ERV