Protein Info for Shewana3_2133 in Shewanella sp. ANA-3

Annotation: peptide methionine sulfoxide reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 4 to 151 (148 residues), 193.4 bits, see alignment E=1.4e-61 PF01625: PMSR" amino acids 4 to 155 (152 residues), 204.1 bits, see alignment E=7e-65

Best Hits

Swiss-Prot: 58% identical to MSRA_METTH: Peptide methionine sulfoxide reductase MsrA (msrA) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 99% identity to she:Shewmr4_2030)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX44 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Shewana3_2133 peptide methionine sulfoxide reductase (RefSeq) (Shewanella sp. ANA-3)
MALATFGAGCFWGVEYFFRQVNGVTNATCGYMGGNNEATTYEEVKKGKTGHAEVVQVEFD
PAIVSYDELLDVFWKNHNPTTLNMQGGDIGTQYRSTIFFHDREQKATAEASKLAFARSGR
WGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHLEY