Protein Info for Shewana3_2112 in Shewanella sp. ANA-3

Annotation: heavy metal translocating P-type ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 transmembrane" amino acids 181 to 204 (24 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 457 to 487 (31 residues), see Phobius details amino acids 755 to 772 (18 residues), see Phobius details amino acids 778 to 799 (22 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 9 to 92 (84 residues), 97.9 bits, see alignment E=1.2e-31 PF00403: HMA" amino acids 100 to 159 (60 residues), 50.1 bits, see alignment 7.6e-17 TIGR01511: copper-translocating P-type ATPase" amino acids 233 to 798 (566 residues), 486.2 bits, see alignment E=3e-149 TIGR01525: heavy metal translocating P-type ATPase" amino acids 251 to 798 (548 residues), 517 bits, see alignment E=1.6e-158 TIGR01512: cadmium-translocating P-type ATPase" amino acids 278 to 800 (523 residues), 383.5 bits, see alignment E=3.1e-118 TIGR01494: HAD ATPase, P-type, family IC" amino acids 285 to 776 (492 residues), 239 bits, see alignment E=1.6e-74 PF00122: E1-E2_ATPase" amino acids 313 to 411 (99 residues), 99 bits, see alignment E=3.1e-32 PF00702: Hydrolase" amino acids 506 to 710 (205 residues), 92.3 bits, see alignment E=1.4e-29 PF08282: Hydrolase_3" amino acids 692 to 730 (39 residues), 26.4 bits, see alignment 1.5e-09

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 100% identity to shn:Shewana3_2112)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KX23 at UniProt or InterPro

Protein Sequence (803 amino acids)

>Shewana3_2112 heavy metal translocating P-type ATPase (RefSeq) (Shewanella sp. ANA-3)
MNIAMTHPSCFHCNEPVLTGTQFVTRINDRDELMCCPGCQAVSQAIVDAGLLSYYKFRTE
PGSKQTALVPDELNQFSAYDLPEVQQDFVHSEENSDSVSLSIDGITCAACAWLIEHKVKQ
LPGVSQVMVNSTTQRAMISWDKQQVKLSDILGQISRIGYQAAPYQVDEQELTAKQNSRKF
LLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFATPVVLYSAQPFYFSA
IRTLLSGKLNMDVSVSIAIGGAYIASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKAR
QKASVSSSNLHKLVPLTAHLVTAQGQEEIPAKKLRLGDIILIKPGEMVAADGIVVDGHTS
INEAMLTGEQMPIEKPVDSQVFAGTINLDQPIKVKVTALGQDQLVAEIIRLQELASNTKP
AVAMLADKLSRYFSGTILTIATITYLVWLQISPEDAFWVTLSVLVATCPCALALATPTAV
TCATAIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGTLSIAKVECHKDFTQEQALA
IAAALESGSRHPIAAAFASFSQTDVIAEQVHHEVGFGVKGLINGTEYRIGNASFTGATAK
PKLANQLIWLARSHNGQLEVIATIEIQDNIRVDSKETVDILKQQGCQVSIASGDSSGHVH
QLAKELGINDVHSGLTPADKLALVTKLQQSTPVAMFGDGINDAPVLAGADLSVAMGSGSA
IAKNSADLILLGDHLSRFTQAVKVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIA
ALGMSASSLIVVGNSLRLLRIKL