Protein Info for Shewana3_2076 in Shewanella sp. ANA-3

Updated annotation (from data): L-arabinose ABC transporter, permease component 2 AraZ
Rationale: Specifically important for L-arabinose utilization; the gene name is from PMC2996990
Original annotation: inner membrane ABC transporter permease protein YjfF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 27 to 28 (2 residues), see Phobius details transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 43 to 82 (40 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 118 to 132 (15 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 308 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 305 (269 residues), 142.9 bits, see alignment E=5.4e-46

Best Hits

Swiss-Prot: 57% identical to YJFF_ECOLI: Inner membrane ABC transporter permease protein YjfF (yjfF) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to she:Shewmr4_1989)

MetaCyc: 57% identical to galactofuranose ABC transporter putative membrane subunit YjtF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Predicted L-arabinose ABC transport system, permease protein 2" in subsystem L-Arabinose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWY7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Shewana3_2076 L-arabinose ABC transporter, permease component 2 AraZ (Shewanella sp. ANA-3)
MIARRFIPLWITASLLLTMFLVGTFQFDGFASGRVVTNLLRDNAFLLITALGMTLVIISG
GIDLSVGAVIALSGVVTSLLITEYQWHPLLAFVVILPLGTLFGALMGTIIHVYKLQPFIV
TLAGMFLARGLATTLSEESIAIDHPFYDAVAEMSIALPGNGALDLSSLIFILFFVIIAVV
MHYTRFGTNVYAIGGNQHSAELMGISIAKTTISIYAISSFLATLAGIVFTFYTFSGYALG
AIGVELDAIAAVVIGGTLLTGGSGFVLGTVLGVILMGVIQTYITFDGSLSSWWTKIVIGL
LLFFFILLQKLLNGRKTQHG