Protein Info for Shewana3_2075 in Shewanella sp. ANA-3

Updated annotation (from data): L-arabinose ABC transporter, permease component 1 AraW
Rationale: Specifically important for L-arabinose utilization; the gene name is from PMC2996990
Original annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 62 to 86 (25 residues), see Phobius details amino acids 100 to 196 (97 residues), see Phobius details amino acids 208 to 234 (27 residues), see Phobius details amino acids 237 to 238 (2 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 97 to 363 (267 residues), 140.2 bits, see alignment E=3.7e-45

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to shn:Shewana3_2075)

Predicted SEED Role

"Predicted L-arabinose ABC transport system, permease protein 1" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWY6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Shewana3_2075 L-arabinose ABC transporter, permease component 1 AraW (Shewanella sp. ANA-3)
MKSSAETLSSTRMSADLISPQMNASEAHSSERQPRMQESHKTMVQEKNARYQAGKSTSMG
RYLWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIAT
GGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIV
ATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFSQLLLRK
TALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDANNAGL
WLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIKAIVIL
TVLLLQSAKFRRQLSALFKSKRHADAKPAEKATSAKASAATGEKL