Protein Info for Shewana3_2072 in Shewanella sp. ANA-3

Updated annotation (from data): L-arabinose 1-epimerase (mutarotase) (EC 5.1.3.3)
Rationale: Specifically important for: L-Arabinose. Was correctly annotated by PMID:20836887 (more specific than EC number); (SEED_correct)
Original annotation: aldose 1-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 39% identical to GALM_ACICA: Aldose 1-epimerase (mro) from Acinetobacter calcoaceticus

KEGG orthology group: K01785, aldose 1-epimerase [EC: 5.1.3.3] (inferred from 100% identity to shn:Shewana3_2072)

MetaCyc: 39% identical to mutarotase (Acinetobacter calcoaceticus)
Aldose 1-epimerase. [EC: 5.1.3.3]

Predicted SEED Role

"L-arabinose-specific 1-epimerase (mutarotase)" in subsystem L-Arabinose utilization

MetaCyc Pathways

D-galactose degradation I (Leloir pathway) (4/5 steps found)
trehalose degradation VI (periplasmic) (1/2 steps found)

KEGG Metabolic Maps

Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.3

Use Curated BLAST to search for 5.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWY3 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Shewana3_2072 L-arabinose 1-epimerase (mutarotase) (EC 5.1.3.3) (Shewanella sp. ANA-3)
MQLSVTQKSLQHAAFADELQLVTLTNSHGLEVVLSNYGASIWSVKLYGQAQEPISLSLGY
QDIKDWVTNPYYFGITAGRVANRIGKAQFPLAGKTIQLVANEGNNQLHGGPKGLSHCTWQ
VEMLQDNDSVAAVFSITSPDGDQGFPGNLAITLEYRLNENNELTLNYQAVCDQTTPVCLT
NHAYWNLASNKQQGILGHELSIQASHFLALDNEQIPTGELILVDDGAYDFKQPKLIATDI
KQLTNGYDHYFVMDRNPDNKNSLQTIAVLKDPLSGRELEISTTEVGVQFYSGNFLDGSHI
DDEGYSINQFHGLCLETHGYPNAVNIDHFPSVMLEANTQYQQITVHKFKNI