Protein Info for Shewana3_2071 in Shewanella sp. ANA-3

Updated annotation (from data): L-arabinose 1-dehydrogenase (EC 1.1.1.46)
Rationale: Specifically important for: L-Arabinose. Also, was correctly annotated by PMID:20836887
Original annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 13 to 200 (188 residues), 160.3 bits, see alignment E=6.2e-51 PF08659: KR" amino acids 14 to 121 (108 residues), 40.3 bits, see alignment E=4.9e-14 PF13561: adh_short_C2" amino acids 21 to 255 (235 residues), 179.8 bits, see alignment E=1e-56

Best Hits

Swiss-Prot: 40% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2071)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWY2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Shewana3_2071 L-arabinose 1-dehydrogenase (EC 1.1.1.46) (Shewanella sp. ANA-3)
MKLTNQYPSLQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQ
PEASVTFYHCDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLN
TNLRHYFFAVQAVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAAD
LGKDKIRINTLTPGWVMTKRQLTHWVDKDTAKHIENNQCIKEYVMPEDIAAMALFLAADD
SKLCTAQNFIVDGGWI