Protein Info for Shewana3_2056 in Shewanella sp. ANA-3

Annotation: formate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF04358: DsrC" amino acids 7 to 112 (106 residues), 151.1 bits, see alignment E=6.4e-49 TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family" amino acids 7 to 112 (106 residues), 166.3 bits, see alignment E=1.2e-53

Best Hits

Swiss-Prot: 68% identical to TUSE_PHOLL: Sulfurtransferase TusE (tusE) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 97% identity to shm:Shewmr7_2007)

MetaCyc: 65% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWW7 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Shewana3_2056 formate dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MVNPLIFNGVEIERDHQGYLKNIADWQPDMAPLLAQEEQIELTSAHWEVVNFVRDFYLEY
KTSPAIRVLVKAIGQALGPDKGNSKYLYTLFPVGPAKQATKIAGLPKPAKCI